Free shipping to NL & BE on orders over €75

Ordered before 5:00 PM, shipped today

Money-back guarantee

  • Nederlands Nederlands
  • English English
Contact us
tegeltechniekshop.nl
Menu
  • Categories
    • Diamond saw blades
          • Diamond saw blades for tile and ceramics
          • Diamond saw blades for concrete
          • Diamond saw blades for brick and sand-lime brick
          • Diamond saw blades universal
          • Diamond disc 2-in-1 and miter
    • Tile drill bits
          • Tile drill bits dry
          • Tile drill bits wet
          • Tile drill bit set
          • Cooling gel for tile drilling
    • Diamond cup wheels
          • Diamond cup wheels for concrete
          • Diamond cup wheels PCD-F (epoxy)
    • Diamond milling bits
          • Diamond milling bits
    • Polishing
          • Polishing pads
          • Diamond sanding blocks
          • Diamond sharpening block (diamond bar)
    • Tile cutters
          • Tile cutter
    • Tile saw machines
          • Long-neck saw and drill machine (Ferrati Fixi)
          • Automatic tile saw machine
    • Diamond drill bits
          • Diamond drill bits (dry)
          • Diamond drill bits (wet)
          • Diamond core drill bit
    • Dust extraction technology
          • Dust extraction for angle grinder
    • Tile suction cups
          • Tile suction cups
    • Accessories
          • Mitre accessories
          • Level system
          • Installation templates / drilling templates
          • Tile grouting
          • Personal protection
          • Spacer rings for saw blades
          • Adapters
    • Concealed mounting systems
          • Concealed flush button
          • Concealed toilet roll holder
          • Concealed ventilation grille
          • Concealed inspection hatch
          • Tile built-in others
    • Gluing and grouting
clear
  • Nederlands Nederlands
  • English English
  1. home
  2. Brands
  3. Tenax

List of products by brand Tenax

Sort by:
Sales, highest to lowest Relevance Name, A to Z Name, Z to A Price, low to high Price, high to low Reference, A to Z Reference, Z to A
  • 
  • 1
  • 2
Showing 13-24 of 24 item(s)

Active filters

Tenax color paste UNIVERSAL 75ml BIANCA - WHITE

Tenax color paste UNIVERSAL 75ml BIANCA - WHITE

€11.99
Tenax Rivo 1L A + 1L B Gel time 15 min. Two-component epoxy adhesive, beige color, frost-resistant.

Tenax Rivo 1L A + 1L B Gel time 15 min. Two-component epoxy adhesive, beige color, frost-resistant.

€64.99
Tenax Glaxs A+B Transparent Glue 2kg

Tenax Glaxs A+B Transparent Glue 2kg

€109.99
Tenax Domo 10 Two-Component Epoxy Glue, very strong, 1L A + 1L B

Tenax Domo 10 Two-Component Epoxy Glue, very strong, 1L A + 1L B

€109.99
Tenax Glaxs Ultrafast – two-part epoxy glue 2+1 50ml

Tenax Glaxs Ultrafast – two-part epoxy glue 2+1 50ml

€14.99
Tenax Booster Alk Tile Cleaner & Porcelain Stain Remover Epoxy residue 1L

Tenax Booster Alk Tile Cleaner & Porcelain Stain Remover Epoxy residue 1L

€18.99
Tenax Briotop all-purpose cleaner 1L

Tenax Briotop all-purpose cleaner 1L

€12.99
Tenax AGER Colour Enhancer, Wet Effect, Water and Oil Resistant - 250ml

Tenax AGER Colour Enhancer, Wet Effect, Water and Oil Resistant - 250ml

€22.99
  • New
Tenax Solido 3G Mastic Bianco - Wit 1L/1.8kg

Tenax Solido 3G Mastic Bianco - Wit 1L/1.8kg

€19.99
  • New
Tenax Solido 3G Mastic Grigio - Gray 1L/1.8kg

Tenax Solido 3G Mastic Grigio - Gray 1L/1.8kg

€19.99
  • New
Tenax Solido 3G Mastic Pagl - Beige 1L/1.8kg

Tenax Solido 3G Mastic Pagl - Beige 1L/1.8kg

€19.99
  • New
Tenax Titanium Liquid - Transparent liquid vinylester glue 1L

Tenax Titanium Liquid - Transparent liquid vinylester glue 1L

€59.99
  • New
  • 
  • 1
  • 2
info@tegeltechniekshop.nl

Categories

Categories  
  • Accessories
  • Diamond milling bits
  • Diamond cup wheels
  • Diamond saw blades
  • Polishing
  • Tile drill bits
  • Tile saw machines
  • Tile suction cups
  • Diamond drill bits
  • Dust extraction technology
  • Tile cutters

Company

Company  
  • About Us
  • Contact
  • Blog

Informations

Informations  
  • Terms and Conditions
  • Privacy Policy
  • Delivery & Shipping Costs
  • Payment methods
  • Return policy
Contact us

Secure payments

mastercardvisapaypalklarnaideal

Fast delivery

post nl

2026 TEGELTECHNIEKSHOP.NL | All rights reserved Made by